PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0346819.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 340aa    MW: 38247.1 Da    PI: 7.8825
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0346819.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.76.8e-51141391128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrF Ptdeel+v+yL++kv+g +++l  +i+e+d+yk++Pw Lp k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++
  Lj0g3v0346819.1  14 LPPGFRFFPTDEELLVQYLCRKVAGYHFSL-PIIAEIDLYKFDPWVLPGKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVITT 106
                      79**************************99.88***************7767799*************************************99 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  Lj0g3v0346819.1 107 -EGRKVGIKKALVFYIGKAPKGTKTNWIMHEYRL 139
                      .999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.59E-6510164IPR003441NAC domain
PROSITE profilePS5100559.80114164IPR003441NAC domain
PfamPF023651.5E-2515139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGVPEKDPLA QLSLPPGFRF FPTDEELLVQ YLCRKVAGYH FSLPIIAEID LYKFDPWVLP  60
GKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVITTEGRK VGIKKALVFY  120
IGKAPKGTKT NWIMHEYRLL DSSRKHKLGS SRLDEWVLCR IYKKKSSTQK EAAATFSSKE  180
CSYGSSSPST SSHVEDMLES LPEIDDRCFA LPRVNSLRTL QQDEKLGSAT GIFTDWGNPT  240
DLDTVPEFVP GSQAQWMGNY SCNDLYVPSV PQFGHVDWSA TTRNTAEEEV QSGVRTHRVA  300
ESSGFYQQNP DLTTQRLLPG SVDPFGFGYL GQQTGFGFRD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-10511704171NO APICAL MERISTEM PROTEIN
1ut4_B1e-10511704171NO APICAL MERISTEM PROTEIN
1ut7_A1e-10511704171NO APICAL MERISTEM PROTEIN
1ut7_B1e-10511704171NO APICAL MERISTEM PROTEIN
3swm_A1e-10411707174NAC domain-containing protein 19
3swm_B1e-10411707174NAC domain-containing protein 19
3swm_C1e-10411707174NAC domain-containing protein 19
3swm_D1e-10411707174NAC domain-containing protein 19
3swp_A1e-10411707174NAC domain-containing protein 19
3swp_B1e-10411707174NAC domain-containing protein 19
3swp_C1e-10411707174NAC domain-containing protein 19
3swp_D1e-10411707174NAC domain-containing protein 19
4dul_A1e-10511704171NAC domain-containing protein 19
4dul_B1e-10511704171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.61400.0floral bud| flower| pod| protoplast| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001238234.10.0NAC domain protein NAC3
SwissprotQ93VY31e-122NAC72_ARATH; NAC domain-containing protein 72
TrEMBLQ52QR30.0Q52QR3_SOYBN; NAC domain protein NAC3
STRINGGLYMA12G22880.11e-180(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44293360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-122NAC family protein